PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Achn273921
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; Ericales; Actinidiaceae; Actinidia
Family Nin-like
Protein Properties Length: 510aa    MW: 58004.1 Da    PI: 7.5523
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Achn273921genomeIKGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK30.85.7e-1042722651
      RWP-RK 26 g.....vclTvLKriCRqyGIkRWPhRkiks 51
                g     v+ ++ Kr CR+yGI+RWP R + +
  Achn273921 42 GtkkksVSISTYKRVCRKYGISRWPPRNVDK 72
                344444999******************9875 PP

2RWP-RK34.34.6e-113493792252
      RWP-RK  22 AkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                  k+  v+ ++ Kr CR+yGI+RWP R + ++
  Achn273921 349 TKKTSVSISTFKRVCRKYGISRWPPRSVDKV 379
                 466679*********************9986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151910.626994IPR003035RWP-RK domain
PfamPF020427.5E-74272IPR003035RWP-RK domain
PROSITE profilePS5151911.729311399IPR003035RWP-RK domain
PfamPF020426.4E-8353379IPR003035RWP-RK domain
SuperFamilySSF542779.81E-11418506No hitNo description
Gene3DG3DSA:3.10.20.2405.1E-9420491No hitNo description
SMARTSM006661.2E-7424508IPR000270PB1 domain
PfamPF005642.5E-11424505IPR000270PB1 domain
PROSITE profilePS5174515.06424508IPR000270PB1 domain
CDDcd059929.58E-9425506No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005515Molecular Functionprotein binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MNCKHRDHRP SGGEIMQVDS SDHQSIDAEQ FEIDVNHPQE LGTKKKSVSI STYKRVCRKY  60
GISRWPPRNV DKGLGLECFD SCEHHETRRG ICSQKYLDTA VLSKQEKNDN KAHKDAFMEI  120
KRVLELVCKI YKLRLALTWV PCGACKTLLP VKDLYWILDF YDVIICNLHD FSMGRLGHHL  180
RNGIGLVGRA LSSPNLLYCS DVTQFSMDEY PLAHFARQCK IRGCFAISLQ SNYTGNDDYV  240
LEIFLPTSNK HEDPLTSLSK ILETMKKEFK TFRLASGEEM GEELSVEVNE IQNGQKRHYV  300
QKLQVTGSLP SLEPLQKRED IIQVNSTDHQ SINAEQCKID LNHPQEIGTK KTSVSISTFK  360
RVCRKYGISR WPPRSVDKVC SHRPSHVDHQ EEVPQLNSNM PSNHASASIA HTQPHDTVMQ  420
NAKTVNIKAK YVEGLMVLFP LSLSSTLEEL YECIETRLPL SRATYHACYI DGDNDKITIT  480
CDQDLQFWLR HSPRLPGSNA VVLHIDPIS*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G24020.18e-40NIN like protein 7